PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G58080.1
Common NameARR18, K21L19.7, RR18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ARR-B
Protein Properties Length: 618aa    MW: 68516 Da    PI: 5.1053
Description response regulator 18
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G58080.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.1e-29177230155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr++W++eLH++Fv+av+qL G +kA+Pk+il+lm+++gLt+e+v+SHLQkYRl
  AT5G58080.1 177 KPRVVWSQELHQKFVSAVQQL-GLDKAVPKKILDLMSIEGLTRENVASHLQKYRL 230
                  79*******************.********************************8 PP

2Response_reg678.5e-2331101109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ l+++l + +y +v+ + ++++ale+l+e+   +Dl++ D+emp+ dG++ll+   e  ++lp+i+++ah++ + + + +  Ga 
   AT5G58080.1   3 VLAVDDNPTCLRKLEELLLRCKY-HVTKTMESRKALEMLRENSnmFDLVISDVEMPDTDGFKLLEIGLE--MDLPVIMLSAHSDYDSVMKGIIHGAC 96 
                   799********************.***************999999******************985344..57************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp+  +el +
   AT5G58080.1  97 DYLVKPVGLKELQN 110
                   ********999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004481.4E-261112IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521725.55E-301118IPR011006CheY-like superfamily
PIRSFPIRSF0363922.8E-1801618IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.3E-331138No hitNo description
PROSITE profilePS5011037.8342116IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-203110IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.61E-1925115No hitNo description
PROSITE profilePS5129411.612174233IPR017930Myb domain
SuperFamilySSF466894.12E-20174234IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-29175235IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-25177230IPR006447Myb domain, plants
PfamPF002492.8E-8179229IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0000156Molecular Functionphosphorelay response regulator activity
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006079anatomyshoot system meristem
PO:0006339anatomyjuvenile vascular leaf
PO:0009031anatomysepal
PO:0009066anatomyanther
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MRVLAVDDNP TCLRKLEELL LRCKYHVTKT MESRKALEML RENSNMFDLV ISDVEMPDTD  60
GFKLLEIGLE MDLPVIMLSA HSDYDSVMKG IIHGACDYLV KPVGLKELQN IWHHVVKKNI  120
KSYAKLLPPS ESDSVPSASR KRKDKVNDSG DEDDSDREED DGEGSEQDGD GSGTRKKPRV  180
VWSQELHQKF VSAVQQLGLD KAVPKKILDL MSIEGLTREN VASHLQKYRL YLKKIDEGQQ  240
QNMTPDAFGT RDSSYFQMAQ LDGLRDFTAA RQIPSSGLLS RSHLTKLQPP MYSSINLQGM  300
NSSSFIQQGH HQNSSNSANP FGTYHSTLSP RIQNVNLFQR TSSPLEPLQF PRSKSYIGDF  360
KGLGDRAIGG SFLDTCMPFG SSSTSLPSAS TNPLMLQANY TQPLHIASDG IQPCIEGTPS  420
NSASPNISFQ GLSRFPGHSW QGNLNTTRFP PSSLPLNLAF LPDQVTCAGN NLGDCTSLVS  480
AENPGGEMQC DPQLLGGFMQ NVNPLGGQKW EQQNCTMLNN PFGNIEYPLP ADNMVFRDNN  540
STRSKGLDES LMNPIDNSQE YVGKATTMLD PEMKSGKPEN DNQHDVFDDI MNEMMKQEEN  600
NGMVPVATRF GFDSFPPP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-24175235363ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139144RKRKDK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.292980.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453593860.0
Genevisible247844_at0.0
Expression AtlasAT5G58080-
AtGenExpressAT5G58080-
ATTED-IIAT5G58080-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in young leaf tissue developing anthers, and siliques. {ECO:0000269|PubMed:15173562}.
Functional Description ? help Back to Top
Source Description
TAIRmember of Response Regulator: B- Type
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins (By similarity). {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. the initial 45 residues are critical for the inhibitory role of the receiver domain to the effector domain in ARR18
    [PMID: 22293116]
  2. ARR18 acts as a transcriptional regulator in plant cells, forms homodimers and positively regulates cytokinin responses.
    [PMID: 22775331]
  3. ARR18 interaction negatively interferes with the transcriptional activity of bZIP63 on the PDH1 promoter.
    [PMID: 24948556]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00057PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G58080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G58080
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G58080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0240290.0AB024029.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K21L19.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_200616.30.0response regulator 18
SwissprotQ9FGT70.0ARR18_ARATH; Two-component response regulator ARR18
TrEMBLD7MPK50.0D7MPK5_ARALL; Predicted protein
STRINGAT5G58080.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142821823
Representative plantOGRP29217120
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Hwang I,Sheen J
    Two-component circuitry in Arabidopsis cytokinin signal transduction.
    Nature, 2001. 413(6854): p. 383-9
    [PMID:11574878]
  3. Hwang I,Chen HC,Sheen J
    Two-component signal transduction pathways in Arabidopsis.
    Plant Physiol., 2002. 129(2): p. 500-15
    [PMID:12068096]
  4. Che P,Gingerich DJ,Lall S,Howell SH
    Global and hormone-induced gene expression changes during shoot development in Arabidopsis.
    Plant Cell, 2002. 14(11): p. 2771-85
    [PMID:12417700]
  5. Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
    In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana.
    Plant Cell Physiol., 2003. 44(2): p. 122-31
    [PMID:12610214]
  6. Heyl A,Schm
    Cytokinin signal perception and transduction.
    Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8
    [PMID:12972049]
  7. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  8. Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
    Type-B response regulators display overlapping expression patterns in Arabidopsis.
    Plant Physiol., 2004. 135(2): p. 927-37
    [PMID:15173562]
  9. Lall S,Nettleton D,DeCook R,Che P,Howell SH
    Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis.
    Genetics, 2004. 167(4): p. 1883-92
    [PMID:15342526]
  10. Brenner WG,Romanov GA,K
    Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades.
    Plant J., 2005. 44(2): p. 314-33
    [PMID:16212609]
  11. Mason MG, et al.
    Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis.
    Plant Cell, 2005. 17(11): p. 3007-18
    [PMID:16227453]
  12. Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
    A transcriptome-based characterization of habituation in plant tissue culture.
    Plant Physiol., 2006. 140(4): p. 1255-78
    [PMID:16489130]
  13. Ishida K,Yamashino T,Yokoyama A,Mizuno T
    Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana.
    Plant Cell Physiol., 2008. 49(1): p. 47-57
    [PMID:18037673]
  14. Gifford ML,Dean A,Gutierrez RA,Coruzzi GM,Birnbaum KD
    Cell-specific nitrogen responses mediate developmental plasticity.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(2): p. 803-8
    [PMID:18180456]
  15. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  16. Liang Y,Wang X,Hong S,Li Y,Zuo J
    Deletion of the initial 45 residues of ARR18 induces cytokinin response in Arabidopsis.
    J Genet Genomics, 2012. 39(1): p. 37-46
    [PMID:22293116]
  17. Veerabagu M, et al.
    The Arabidopsis B-type response regulator 18 homomerizes and positively regulates cytokinin responses.
    Plant J., 2012. 72(5): p. 721-31
    [PMID:22775331]
  18. Veerabagu M, et al.
    The interaction of the Arabidopsis response regulator ARR18 with bZIP63 mediates the regulation of PROLINE DEHYDROGENASE expression.
    Mol Plant, 2014. 7(10): p. 1560-77
    [PMID:24948556]